PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.ML9JR
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB
Protein Properties Length: 988aa    MW: 110048 Da    PI: 4.9039
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.ML9JRgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13e-163683148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lvd+v+++G g+W+++ r  g+ R++k+c++rw ++l
      Aradu.ML9JR 36 KGPWTSIEDAILVDYVTKHGEGNWNAVQRNSGLARCGKSCRLRWANHL 83
                     79******************************************9986 PP

2Myb_DNA-binding50.83.8e-1689132146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ +++++++++G++ W++ a++++ gRt++++k++w++
      Aradu.ML9JR  89 KGAFTEEEERRIIELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 132
                      799*******************.*********.***********96 PP

3Myb_DNA-binding52.79.8e-17503550148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT  Ed +lvd+vk+ G g+W+++ r+ g+ R++k+c++rw ++l
      Aradu.ML9JR 503 KGPWTSAEDAILVDYVKKNGEGNWNAVQRHSGLARCGKSCRLRWANHL 550
                      79******************************************9986 PP

4Myb_DNA-binding50.83.8e-16556599146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ +++++++++G++ W++ a++++ gRt++++k++w++
      Aradu.ML9JR 556 KGAFTEEEERRIIELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 599
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.8883183IPR017930Myb domain
SuperFamilySSF466891.57E-2834130IPR009057Homeodomain-like
SMARTSM007172.6E-123585IPR001005SANT/Myb domain
PfamPF002491.0E-123683IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-223790IPR009057Homeodomain-like
CDDcd001671.57E-93883No hitNo description
PROSITE profilePS5129425.57384138IPR017930Myb domain
SMARTSM007172.3E-1688136IPR001005SANT/Myb domain
PfamPF002494.4E-1589132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-2591136IPR009057Homeodomain-like
CDDcd001673.67E-6103132No hitNo description
PROSITE profilePS5129415.549498550IPR017930Myb domain
SuperFamilySSF466896.36E-29501597IPR009057Homeodomain-like
SMARTSM007175.5E-13502552IPR001005SANT/Myb domain
PfamPF002495.8E-14503550IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-22504557IPR009057Homeodomain-like
CDDcd001674.68E-10505550No hitNo description
PROSITE profilePS5129425.415551605IPR017930Myb domain
SMARTSM007175.1E-16555603IPR001005SANT/Myb domain
PfamPF002494.4E-15556599IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-24558603IPR009057Homeodomain-like
CDDcd001673.67E-6570599No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 988 aa     Download sequence    Send to blast
MSSMTNMGDG RKVSKSRQSS SSDEEAKTGG EGHLKKGPWT SIEDAILVDY VTKHGEGNWN  60
AVQRNSGLAR CGKSCRLRWA NHLRPDLKKG AFTEEEERRI IELHAKMGNK WARMAAELPG  120
RTDNEIKNYW NTRIKRMQRS GLPIYPPDIC FRVMHGNQES QNVGRLTDGV NQHDDLSQTD  180
TLNIPELDFK HVKIPLDPSI FDIPENSMFE QSSDSSHGYN MFPIMHPAKR LRESAEIMQY  240
GPVYEEDYMS DEITNQFHGN TCCSSSSSMP LSGGMKLELP SLQYLETQQG IWDTPASPLP  300
SLESVDTLSS GLLEPIMYQP MKHFQVQETP DEAVKCKPEW DESGEPYSPL AQSSASVLTM  360
CSPDGPQSVE NSDHNIKHEL GTEFPTYCSG KDEKNMNQIH VTRPDALLDL AWFENSVVNC  420
DGESFRKDAL NTFFDHPTAA DLDVITSTTA VTLYTPLLAK VYSMSTMTNK CDGRKVSKVR  480
RPSSSVEEDS GESNVGGEGH LKKGPWTSAE DAILVDYVKK NGEGNWNAVQ RHSGLARCGK  540
SCRLRWANHL RPDLRKGAFT EEEERRIIEL HAKMGNKWAR MAAELPGRTD NEIKNYWNTR  600
IKRMQRAGLP IYPPDVCLRV MHGNQESVNV GTLRDEANQH DDLSQTDTLD IPELDFKLVK  660
LCPGLSYGTS ICDIPESSMV EMSSDSSHGY NHMFPVMPPS KRLRESDMQY GYLDSCISDS  720
VPIFEQYGDY TCDKISDHTQ LSSPCDPILN TSDQFHGDDT YGSHAPLNGN TSSSSVPLPG  780
AMKLELPSLQ YFETQHGIWG TPASPLPSLE SVDTMIQSPP AKPSPSDPVS PERSGLLEAI  840
IYQPKQLQVA NNNSLQATPN DCVRKEVKIS TMKCKPECDE QGGPHFPLGQ SAASVATNYT  900
TSISMCLVDA PQSVETIQDH NIKQELGTQY PAYVSGKKEN WNQIDFTRPD ALLDLGWFGS  960
GIDCDDYDGD QFLFKDALSP FLGQDPDG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-31346035106B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015958481.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_015958482.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A0R0GJT20.0A0A0R0GJT2_SOYBN; Uncharacterized protein
TrEMBLK7LXA10.0K7LXA1_SOYBN; Uncharacterized protein
STRINGGLYMA13G04031.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.39e-90myb domain protein 33